Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris
Basic science published in Chin J Nat Med (2016)
Abstract
The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.
Abstract sourced from PubMed (NCBI) for the cited record. See the original publication for the authoritative version.
Zusammenfassung
Novel 36-amino-acid amidated neuropeptide Y-HS from H. sylvestris salivary gland inhibits TNF-alpha, IFN-gamma, IL-6, and MCP-1, suggesting blood-feeding immunomodulation.
Warum dies für die Hirudotherapie relevant ist
Diese Studie isolierte und charakterisierte ein neuartiges 36 Aminosäuren umfassendes Neuropeptid Y (Neuropeptid Y-HS) aus den Speicheldrüsen des hämatophagen Blutegels Haemadipsa sylvestris, bestimmte dessen Sequenz und den amidierten C-Terminus und wies inhibitorische Effekte auf die Produktion von TNF-α, IFN-γ, IL-6 und MCP-1 in einem ELISA-basierten Assay nach, mit MTT-Assays zur Proliferation/Viabilität. Für ASH ist dies als Charakterisierung einer immunmodulatorischen Komponente des Blutegelspeicheldrüsenkomplexes relevant, möglicherweise bedeutsam dafür, wie Blutegel während des Saugens die Entzündung des Wirts unterdrücken. Die Einschränkung ist, dass H. sylvestris kein Standard-Blutegel für medizinische Zwecke ist, der in der Hirudotherapie verwendet wird, und die antientzündlichen Effekte ausschließlich in vitro gezeigt wurden, ohne Validierung am ganzen Tier, in vivo oder klinisch; die postulierte Rationale der Wirtsblutmahlzeit ist interpretativ und nicht direkt belegt.
Zitation
Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris.
Liu WH et al. · Chinese journal of natural medicines, 2016
Verwandter klinischer Kontext
Erfahren Sie, wie diese Forschung mit der klinischen Praxis verknüpft ist
Zur ASH-Bibliothek hinzugefügt: May 27, 2026 · Letzte Aktualisierung der Website: 18. Juni 2026