Identifizierung und Charakterisierung eines neuen Neuropeptids (Neuropeptid Y-HS) aus der Speicheldrüse des Blutegels Haemadipsa sylvestris

The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.

Abstract aus PubMed (NCBI) für den zitierten Eintrag, in der Originalsprache wiedergegeben. Maßgeblich ist die Fassung der Originalpublikation.

Das Abstract wird nicht übersetzt, damit die eigene Wortwahl der Autoren erhalten bleibt.

Aus Speicheldrüsenextrakten von Haemadipsa sylvestris wurde durch Sephadex-G-50-, Resource-S- und RP-HPLC-Chromatographie ein neues Neuropeptid Y (Neuropeptid Y-HS) gereinigt; Sequenz und Vorläufer-cDNA wurden mittels Edman-Abbau, MALDI-TOF-MS und Klonierung aufgeklärt. Das Peptid aus 36 Aminosäureresten mit amidiertem C-Terminus hemmte die Produktion der Entzündungsmediatoren TNF-α, IFN-γ, IL-6 und MCP-1 signifikant. Es ist das erste aus Blutegeln identifizierte Neuropeptid Y; seine Anwesenheit könnte laut Autoren die Blutmahlzeit erleichtern und Entzündungen hemmen.

Erfahren Sie, wie diese Forschung mit der klinischen Praxis verknüpft ist

Weitere begutachtete Studien in der Kategorie „Speichel-Pharmakologie“.

• Medizinische Blutegel und Hirudotherapie — Gödekmerdan A et al. (2011)
• PEROXIDATION OF SALIVA LIPIDS IN PATIENTS WITH POSTCOVID SYNDROME DURING HIRUDOTHERAPY — Serikbayeva S et al. (2024)
• Medizinische Blutegeltherapie bei Schmerzsyndromen: eine narrative Übersichtsarbeit — Koeppen D, Aurich M, Rampp T (2014)
• Immunmodulatorische Wirkungen des Speichelextrakts des medizinischen Blutegels auf in vitro aktivierte Makrophagen — Ayhan H et al. (2024)
• Proteinaseinhibitoren aus dem medizinischen Blutegel Hirudo medicinalis — Baskova I, Zavalova L (2001)
• Polyfunktionalität der Destabilase, eines Lysozyms aus einem medizinischen Blutegel — Baskova I, Zavalova L (2008)
• Mach es doppelt: Identifizierung und Charakterisierung eines Tandem-Hirudins aus dem asiatischen medizinischen Blutegel Hirudinaria manillensis — Lukas P et al. (2022)
• Use of the medicinal leech in the treatment of ear diseases — Seleznev K et al. (1992)
• Rekombinante Destabilase aus Hirudo medicinalis kann menschliche Blutgerinnsel in vitro auflösen — Bobrovsky P et al. (2021)
• Auswirkungen der Umweltdispersion von Kohlenstoffnanoröhren auf einen aquatischen Wirbellosen, Hirudo medicinalis — Girardello R et al. (2015)

Alle von der ASH analysierten Studien →