Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris
Basic science published in Chin J Nat Med (2016)
Abstract
The present study was designed to identify immunomodulatory components from the leech salivary gland of Haemadipsa sylvestris. The Sephadex G-50, Resource(TM) S column chromatography and reverse-phase high performance liquid chromatography (RP-HPLC) were used to isolate and purify the salivary gland extracts (SGE). Structural analysis of isolated compounds was based on Edman degradation and matrix assisted laser desorption ionization time-of-flight mass spectrometer (MALDI-TOF-MS). The cDNA encoding the precursor of the compound was cloned from the cDNA library of the salivary gland of H. sylvestris. The levels of inflammatory mediators, including tumor necrosis factor-α (TNF-α), interferon γ (IFN-γ), interleukin-6 (IL-6), and monocyte chemotactic protein-1 (MCP-1) were assayed using an enzyme-linked immunosorbent assay (ELISA). The effects on cell proliferation and cell viability were observed using MTT assay. A novel neuropeptide Y (Neuropeptide Y-HS) from the leech salivary gland of H. sylvestris was purified and characterized. It was composed of 36 amino acid residues and the amino acid sequence was determined to be FLEPPERPAVFTSVEQMKSYIKALNDYYLLLGRPRF-NH2, containing an amidated C-terminus. It showed significant inhibitory effects on the production of inflammatory cytokines including TNF-α, IFN-γ, IL-6, and MCP-1. Neuropeptide Y was identified from leeches for the first time. The presence of neuropeptide Y-HS in leech salivary gland may help get blood meal from hosts and inhibit inflammation.
Abstract sourced from PubMed (NCBI) for the cited record. See the original publication for the authoritative version.
Резюме
Novel 36-amino-acid amidated neuropeptide Y-HS from H. sylvestris salivary gland inhibits TNF-alpha, IFN-gamma, IL-6, and MCP-1, suggesting blood-feeding immunomodulation.
Почему это важно для гирудотерапии
В данном исследовании из слюнных желез гематофагной пиявки Haemadipsa sylvestris был выделен и охарактеризован новый нейропептид Y, состоящий из 36 аминокислот (Neuropeptide Y-HS), определена его последовательность и амидированный C-конец, а также продемонстрирован ингибирующий эффект на продукцию TNF-α, IFN-γ, IL-6 и MCP-1 в анализе на основе ELISA с использованием МТТ-тестов для оценки пролиферации/жизнеспособности. Для ASH эта работа имеет значение как характеристика иммуномодулирующего компонента слюнной железы пиявки, что потенциально проливает свет на то, как пиявки подавляют воспалительную реакцию хозяина во время питания. Ограничением является то, что H. sylvestris не является стандартной медицинской пиявкой, используемой в гирудотерапии, а противовоспалительные эффекты показаны исключительно in vitro, без проверки на целом организме, in vivo или клинической валидации; предполагаемое обоснование питания кровью хозяина носит интерпретативный характер и прямо не доказано.
Цитирование
Identification and characterization of a novel neuropeptide (neuropeptide Y-HS) from leech salivary gland of Haemadipsa sylvestris.
Liu WH et al. · Chinese journal of natural medicines, 2016
Связанный клинический контекст
Узнайте, как это исследование связано с клинической практикой
Добавлено в библиотеку ASH: May 27, 2026 · Последнее обновление сайта: 18 июня 2026 г.